Revision of a critical summary paper Writing Assignment Help

Revision of a critical summary paper Writing Assignment Help. Revision of a critical summary paper Writing Assignment Help.


(/0x4*br />

make revisions to the document “A1667”

Follow the requirements on the document “critical summary”

Only Required Source:

Ellison, Ralph. “A Party Down at the Square.” ESQUIRE-NEW YORK- 127 (1997): 90-94.

Ramsey, Paul J. “GOD BLESS YOU, MR. VONNEGUT.” Curriculum & Teaching Dialogue 11 (2009).

Use the second source while critiquing to better elaborate a point.

Summary: Your summary should identify what key points or themes the author is attempting to convey in the article. Some of this should be concentrated in the introduction, but should also be spread out through the remainder of the paper. The summary portion should be a brief explanation of a key point or theme using evidence from the article to better explain what the author is attempting to state.

Critique: The critique should be a balanced discussion and evaluation of the strengths, weakness and notable features of the text. Remember to base your discussion on specific criteria. Good reviews also include other sources to support your evaluation (remember to reference). The critical analysis portion of this assignment will be to critique in a negative or positive manner what you believe the author is attempting to state. Remember to stay objective and in third person.

Revision of a critical summary paper Writing Assignment Help[supanova_question]

Your final research proposal should consist of your 1. Introduction section with the purpose of the study and research question, and why your research is significant to the area of death and dying and who would benefit from your research. Writing Assignment Help

Comprehensive Assignment – Submission of your Final Research Proposal

Your final research proposal should consist of your 1. Introduction section with the purpose of the study and research question, and why your research is significant to the area of death and dying and who would benefit from your research. 2. Your literature review which should give an overview of peer-reviewed academic journal research (at least 5-8 articles) that deal with your topic and would help you to understand what research has been conducted related to your research question. Your literature review should have an opening and conclusion paragraph. The closing paragraph should identify any gaps in the literature and discuss what the main research methods are that have been used to research your topic. 3. Your methodology section describing how you would go about researching this topic including method, procedures, and any ethical issues with the research.

[supanova_question]

Reviewing an answer for PROTEIN BIOENGINEERING Science Assignment Help

I have answer this questions but I am not sure if that is right so I want some one to fix and improve my answer if needed! please check fille call Homework 2 for more information for the ass

A fragment of human progranulin (PGRN, Homo sapiens) is overproduced in several human cancers.The fragment’s amino acid sequence is

GAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL

The fragment contains six repeats called granulins with the sequence pattern of

XXXCX…XCX…XCCX…XCCX…XCCX…XCCX…XCXXXXXX

where X is any amino acid residue, C is cysteine, … stands for one to several arbitrary amino acid residues in a row.

You would like to use one of the repeats (specifically, human granulin A, or hGrnA) as a protein marker for early cancer detection. As a part of your efforts to develop the diagnostic kit, you would like to quantify molecular interactions (affinity) between hGrnA and its cellular receptor (a protein known to bind hGrnA and trigger cell division upon binding).hGrnA is the third repeat out of the six if counting from the N-terminus.

To produce hGrnA you have decided to sub-clone it into the Novagen expression vector pET-21a between restriction sites HindIII and XhoI.The recombinant DNA construct must have the following specifications: a) The enterokinase cleavage site DDDDK to ensure that the N-terminal amine of the recombinant hGrnA after treatment with enterokinase is free and available for binding to the receptor; b) An arginine residue (R in one-letter code, Arg in three letter code) immediately after the last residue of hGrnA to improve the construct solubility, and c) a C-terminal hexahistidine tag after (His-tag, His6) to enable hGrnA purification.

Your assignment is:

  • Identify the amino acid sequence of hGrnA for subcloning.
  • Design the DNA sequence encoding hGrnA optimized for Escherichia coli expression (use any K12 E. coli strain) and amenable for cloning between HindIII and XhoI restriction sites.Make sure that the back-translated optimized DNA sequence of hGrnA does not contain restriction sites HindIII and XhoI.Use genomes.urv.es/OPTIMIZER as shown during the class (codon usage HEG, method “guided random”).
  • Design two primers (one forward and one reverse) with melting temperatures Tm equal to approximately 60-62°C for subcloning the synthetic gene into the pET-21a plasmid and creating a recombinant DNA construct that will satisfy the specifications a)-c).

The report must be submitted as a Word file.

[supanova_question]

Argumentative essay: You must write this on one of the topics you were given in the module. Make sure you read through all three possible topics carefully and select only one. Writing Assignment Help

Argumentative Essay Assignment SheetWhat is it? In this type of assignment, you take a stand on a particular topic that is debatable. You present a clear and strong thesis statement in your first paragraph to assert your position on the topic. You then provide strong, logical evidence that supports the validity of your argument throughout your paper. However, you will not research this topic. Consider your audience! Who is the intended audience of your paper? Knowing your audience is essential to making a strong argument. Ask yourself the following: What does your audience value and believe? For the purposes of this assignment, you are going to assume that the audience disagrees with your stand. Keep this in mind when writing the paper. Your argument is going to be more convincing if you show that you have taken the situation of your audience into account.How will their interests be affected by the issue? In other words, why should your audience care about this issue? This question can also be broader—why should anyone care about this issue? What kind of evidence will be most effective with them? Your evidence will be based on your personal experience and that of one of the articles included in the module. DO NOT RESEARCH or PLAGIARIZE! If you have questions about this, ask! Even short passages taken from an outside source will constitute plagiarism.For this essay, you may write in either first or third person point of view. However, you will avoid “I feel” or “I believe” or “I think” statements. Do not write in second (you, your, you’re). What are the requirements?Your argumentative essay will include the following:

1. You will select a topic from those listed in the module using the articles and you will include directly quoted passages from the article you select in your essay as evidence. When using passages from the article, quote them and introduce them fully using the author’s name and the title of the article as shown in the example in the module.

2. Have a clear thesis with a topic, how you feel about it, and why (see the examples in the module).

3. Include all of the important details—who, what, where, when, and why.

4. Include evidence from your own experience as well as evidence from an article in the module.

5. Include refutation—what is the opposition likely to say? This is where you will note what those against your argument are likely to counter-argue. You will then refute this argument and state why it is not as strong as your own stand. Remember to make it clear this is refutation and not your stand.

6. Conclude with a summation of the essay and perhaps a question or idea that leaves the reader with something to consider.

An example outline to help you with your writing would be the following:INTRODUCTION: Usually first paragraph but could be first two paragraphs. Make your introductory paragraph interesting. How can you draw your readers in? What background information, if any, does the reader need to know in order to understand your claim? Give your thesis at the end of the introductory paragraph and make sure it includes the topic, what you will argue about it (your stand) and why. NEXT: SUPPORTING EVIDENCE PARAGRAPH: Usually this is one paragraph but it can be longer. What is one item, fact, detail, or example you can tell your readers that will help them better understand your claim/paper topic? Your answer should be the topic sentence for this paragraph. Introduce your evidence either in a few words (As so in so states in the article from the module.) What supporting evidence (reasons, examples, personal examples, examples from the article you selected) can you include to prove/support/explain your topic sentence? Explain Evidence: How should we read or interpret the evidence you are providing us? Remember, this is

personal evidence or evidence from the article but not researched evidence. How does this evidence prove the point you are trying to make in this paragraph? Link this evidence to your thesis.SUPPORTING EVIDENCE PARAGRAPH #2, 3, 4 or however many paragraphs you use for evidence (at least 2). Repeat above. COUNTERARGUMENT PARAGRAPH or REFUATION: PURPOSE: To anticipate your reader’s objections; make yourself sound more objective and reasonable. Usually 1-2 paragraphs. What possible argument might your reader pose against your argument and/or some aspect of your reasoning? Insert one or more of those arguments here and refute them. End paragraph with a concluding sentence that reasserts your paper’s claim as a whole. Make it very clear that this is what the opposition would think and not what you are asserting. CONCLUSION: Remind readers of your argument and supporting evidence. Restates your paper’s overall claim and supporting evidence. How long should it be?At least 2 full pages. This is a minimum requirement that you must meet. You may always go over the minimum but never under. It must be turned in on time; (you are allowed one late essay for the semester, but it will receive a one

letter grade reduction).

Your paper will be set up in MLA style as shown in the paper layout power-

point in the module.

How will it be assessed?

The rubric gives the details on this. You can also review the sample essays

in the text and modules.

Option 1: For your argumentative essay, read the following and respond to it using a clear

thesis, background information, definition of the topic, proofs, and refutation (as explained in

the power-point and the textbook). You will not research this topic. Instead, you will respond

to this article. You will use directly quoted passages from the article for support. You will

document these passages by introducing the author’s full name and the title of the article on

first reference and then using the author’s last name after the quoted or summarized passages

in parentheses like this (Richie). These passages should represent a very small percentage of

your essay. Your words should take up more than 80% of the essay’s two-page minimum. As

always, set this up as you have all previous assignments in MLA style.

Technology is supposed to make us more connected. We can stay in touch with our friends all the

time on Facebook, Twitter and Tumblr, and, of course, by texting. But are our smartphones

actually getting in the way of real socializing? Could technology be making us more alone?

In the article “

Disruptions: More Connected, Yet More Alone,” Nick Bilton writes about a

YouTube video that comments on our smartphone-obsessed culture.

Last weekend, I was watching television with a few friends, browsing the week’s most popular

YouTube videos, when a piece in the comedy section called “I Forgot My Phone” caught my

eye. As I was about to click play, however, a friend warned: “Oh, don’t watch that. I saw it

yesterday, and it’s really sad.”

The two-minute video, which has been viewed more than 15 million times, begins with a couple

in bed. The woman, played by the comedian and actress Charlene deGuzman, stares silently

while her boyfriend pays no mind and checks his smartphone.

The subsequent scenes follow Ms. deGuzman through a day that is downright dystopian: people

ignore her as they stare at their phones during lunch, at a concert, while bowling and at a

birthday party. (Even the birthday boy is recording the party on his phone.) The clip ends with

Ms. deGuzman back in bed with her boyfriend at the end of the day; he is still using his phone.

Ms. deGuzman’s video makes for some discomfiting viewing. It’s a direct hit on our

smartphone-obsessed culture, needling us about our addiction to that little screen and suggesting

that maybe life is just better led when it is lived rather than viewed. While the clip has funny

scenes — a man proposing on a beach while trying to record the special moment on his phone —

it is mostly … sad.

Students:

Tell me …

Does technology make us more alone? Do you find yourself surrounded by people who

are staring at their screens instead of having face-to-face conversations? Are you ever guilty of

doing that, too?

Is our obsession with documenting everything through photographs and videos

preventing us from living in the moment?

Do you ever try to put your phone down to be more present with the people in the room?

Do you have rules for yourself or for your friends or family about when and how you use

technology in social situations? If not, do you think you should?

Do you think smartphones will continue to intrude more into our private and social

spaces, or do you think society is beginning to push back?

[supanova_question]

Product Sell Sheet Business Finance Assignment Help

The assignment is to create a one page products sell sheet for a product I came up with which is a fiber glass bottle. Attached are all the work and information you need about my product. Please review all the documents attached and incorporate all the information I wrote into the product sell sheet. Also attached is an example of a product sell sheet that you should very carefully follow. I expect for all of the information that I provided to be used exactly as is in the product sell sheet. I also attached a design I created for the fiber glass bottle that you need to incorporate in the product sell sheet. Please make sure the total outcome has the correct and precise information as well as a nice design just like in the product sell sheet example. Last but not least, please provide a box on the left upper corner of that document you’re going to make in order for me to put the information in just like the example.

[supanova_question]

[supanova_question]

When God is the Abuser? Writing Assignment Help

Engaging the Bible: When God is the Abuser?

READ Hosea 1-3; Ezekiel 16 from the bible

AND the attached “Dawn Robinson Rose, Insider Out: Unmasking the Abusing God”

( do not bring the bible reading main ideas. the main ideas should be taken from the article only) the bible reading is just to link the article to it

———————

You can access bible through https://bible.oremus.org/)

The reading article is attached

The only reference should be the attached only

—————–

This homework assignment will help ensure a dynamic classroom experience, and it will aid in progress on the course learning outcomes:

  • Understand key questions and issues with respect to the application of the Bible to modern justice issues
  • Critically analyze ways in which the Bible has, is, or could be used to address modern injustices
  • Recognize the complexity in any attempt to apply ancient biblical texts to justice concerns in the modern world
  • Think critically about one’s own fundamental views with respect to the Bible and contemporary justice issues

Include the following

  • Identify the main ideas of the assigned reading.
  • Identify two things you found interesting and want to discuss in class.
  • Identify at least one question you have upon completion of the reading. This should not be a “google question” (i.e., What are “Euroamericans”?). (You may include more than one question.)

When God is the Abuser? Writing Assignment Help[supanova_question]

answer these application essay questions below Writing Assignment Help

Please make fully relate my background info to these questions and catch admission officer’s eyes

1.Give a candid description of yourself (who are you as a person), stressing the personal characteristics you feel to be your strengths and weaknesses and the main factors which have influenced your personal development, giving examples when necessary (maximum 500 words). *

My background info:I have sufficient experience in humanities, and I like literature and art. I have strong logic. In project management, I have clear thinking and high efficiency.

What affects my development is the development of Beijing and China.

At the beginning, I worked as a cultural and educational journalist, and witnessed the development of film, television, culture and education in China. From the technology, concept, concept and Europe and the United States are far from the box office over 10 billion, 20 billion, is the world’s second largest film market.

Participate in large-scale sports events in China. Although it is a sports competition, what I participate in is a cultural and educational project, namely the department of humanities, which teaches young people how to maintain a fair and beautiful world.

Then I went to work on a large film project, just like managing a cultural and educational activity, the film project is a large cultural and educational project, just like the previous job. Because of the huge amount of money invested in film and television in China, I participated in several blockbuster movies in China. I was a publicist and discussed the director’s selling point and marketing strategy with the director and the producer.

With the sluggish and non-standard Chinese film market, I realized that I should give full play to my international advantages. Therefore, I chose wiley company in the United States, which could combine my previous marketing experience, cultural and educational background and project management.

Now I choose MBA, because I feel that I lack business management knowledge. Although I can learn while working in the future, I want to learn MBA systematically, so as to help me go back to China in the future, engage in management of culture and education industry, and catch up with the development speed of China.

2.Describe the achievement of which you are most proud and explain why. In addition, describe a situation where you failed. How did these experiences impact your relationships with others? Comment on what you learned(maximum 400 words). *

My background info:Give my project management experience.

Youth Olympics Organizing experience: I had 40 Olympic champions and the President of the international Olympic committee.

I managed all the vips successfully, which was different from other activities. This was done by the international organization at the level of diplomacy national security. Organizing committee Third Class Award (0.02%).

Failure experience: lack of systematic business knowledge, unable to analyze the current company’s problems from a higher perspective.

3.Describe all types of extra-professional activities in which you have been or are still involved for a significant amount of time (clubs, sports, music, arts, etc). How are you enriched by these activities? (maximum 300 words) *

My background info:Yoga ( intermediate )that helps me breathe, relax, pace, and philosophy, to understand myself, others, work management, and the world. Etc etc. You can provide more extra-professional activities to polish my experience.

4.Is there anything else that was not covered in your application that you would like to share with the Admissions Committee? (maximum 300 words)

5.Summarise your current (or most recent) job, including the nature of work, major responsibilities, and where relevant, employees under your supervision, size of budget, Clients /products and results achieved. (200 words maximum) *

My background info:The management budget is $500,000 a year

Five subordinates.

– responsible for the marketing of online education products and platforms such as test preparation, Chinese and foreign degrees, and vocational certificates of John wiley. WILEY China test preparation products, including publishing GMAT, CFA, CMA and other official examinations. Textbooks, online video courses. And the business expansion of chinese-foreign cooperation in running schools with Chinese schools.

-independently plan and execute the annual marketing strategy plan, including B2B and B2C operation and content plan.

– liaise closely with us headquarters, report weekly on progress, understand and localize the global marketing strategy.

-planned and organized business summits, forums, overseas professors’ professional Tours and industry activities, etc.

-responsible for the operation of wiley education’s social media content planning and promotion programs, including WeChat, weibo, youku and zhihu.

– clients include GMAC,CFA institute, IMA, and some XXX universities.

6. What would be your next step in terms of position if you were to remain in the same company? 200 words (maximum) *

I will be a Wiley Efficient Learning products senior director of https://www.efficientlearning.com/. Responsible for the cooperation project of overseas professional learning, certificate and University degree that will bring more professional exams and K12 courses from North America to China, as well as the introduction of north American universities and other universities.

Therefore, I need to make up for my shortcomings in business operation, transnational cooperation and so on, so I need to study for this MBA

7. Do the difference a full description of your career since graduating from university. Describe your career path with the rationale comment behind your choices. (300 words maximum) *

Can consider the focus in the field of culture and education, reflecting their humanistic background.

Undergraduate studies film, media related.

A journalist works in the culture and education department of the newspaper.

The Olympic sports for the ministry of culture and education projects, that is not engaged in competitive sports, but the dissemination of the Olympic Games and the spirit of humanity.

Feiyang entertainment does marketing for entertainment and cultural projects.

Wiley also works for education.

8. Discuss your short and long term career aspirations with an MBA. 100 words (maximum) *

The cultural and educational background helps me to understand the humanistic aspects of the project.

But China’s culture and education industry, extremely real management and business talent.

Cultural, educational and entertainment companies can’t.

I hope I can make up for my business management knowledge and become a business management talent with cultural and educational background in China’s culture, education and entertainment industry.

[supanova_question]

PUAD725 Management Decision Making Methods Mathematics Assignment Help

This assignment is due at the end of Week 3.

Miller (2002) states that “problem solving is the grandfather of performance improvement” (p. 145). When you work through the process of problem solving you will find that you are prevented from coming up with conclusions or decisions that are erroneous or poorly defined.

Before you can define the problem at the organization you must analyze it using information drawn from the case. According to Miller (2002) data gathering consists of three parts:

  • Collecting
  • Displaying
  • Analyzing

In this assignment you must analyze the performance problem(s) of the organization in the case and its causes. As part of the this analysis you will have to apply tools for analyzing quantitative data and techniques for assessing root causes of a systemic organizational performance problem. This analysis should enable you to define the fundamental performance problem(s) at the organization, identify their root causes and develop potential strategies for improvement.

Figure 5.1 Problem-solving process Miller, 2002, p. 147

ACTION ITEMS

  1. Complete your required reading. Review the case. Watch the video Problem Solving Techniques #3: Cause and Effect Diagrams.
  1. Read the rubric.
  1. Collect data from the DMV Case Study.definition of analysis and synthesis
  1. Display the data. Use the organization’s data provided in the case and these instructions to create the following displays:
  1. Pareto chart of customer complaint types
  2. Run chart of weekly processing times
  3. Histogram of processing times
  4. Scatter plot of Processing Time and Time of Day
  1. Analyze the data in your displays. Write a paragraph explaining any key insights you gained from creating and analyzing the displays and diagrams.
  1. Use the information from the case and your data to identify the performance problem you consider to be the most important and the cause(s) of that problem.
  1. Create a cause-and-effect diagram (fishbone) showing what you consider to be the most important performance problem and the cause(s) that create that problem.
  1. Write a 2-3 page narrative of your analysis that includes:
  1. A description of the systemic performance problem(s) facing the organization
  2. An explanation of the root cause(s) of the most important performance problem and how each one contributes to the problem

Notes:

  • You may want to include one of your diagrams/displays in your narrative. If you do, it can be no larger than ½ of one page.
  • Write your narrative from this perspective: Your boss has asked for a concise explanation of the problem and the causes in 3 pages or less.
  1. Attach a 4-5 page Appendix to your narrative that includes your four data displays and explanations, and the cause-and-effect diagram you created for the most important performance problem. Follow APA formatting and style guidelines for Appendices and figures.

Note: This narrative and analysis will become the third section of your report. (See the Begin Performance Improvement Report object for a full description of the report).

  1. Submit your paper to Turnitin and review the originality report. If your report states that more than 24% of your document is not original thought, rework your paper so that it is written in your own words. Make any other revisions necessary based on the originality report (e.g., include citations).
  1. Review the rubric to confirm that you have met or exceeded the requirements for this assignment. Copy and paste the rubric at the end of your document.

Please this are the require readings

  • Miller, K. (2010). We don’t make widgets: Overcoming the myths that keep government from radically improving. Government Management Series. Washington, D.C.: Governing Books.
    • Chapters 5, 6, and the Appendix

[supanova_question]

Ethnic Studies Question. Writing Assignment Help

Using the following links for readings:

  1. It’s Non-Negotiable. We Have to Teach Social Justice in Our Schools. (Short Read) (Links to an external site.)
  2. Why Ethnic Studies is Good For All Americans (Short Read)

Address the following question using ONLY the course content you have engaged in. Just work with what you have read. In other words, just use the sources you have already read. It’s OK if you’re not done. Just work with what you know.

Question: According to the unit, why is it valuable to all Americans to understand the complexity of the American identity?

Directions:

  1. Restate the question into a statement. Yup. that easy. This becomes your topic sentence – Your argument. It’s that easy. Don’t over think it. Just keep the topic sentence simple.
  2. Now, using the inspiration from the course content, explain the answer. Do not use specificities examples yet. Just explain yourself using the course content to inspire your writing.
  3. Use the unit language. BOLD your applied unit language.
  4. Be cohesive.
  5. Do not use specific evidence. (I know that sounds weird but my feedback will help you with your unit assessment explained in week two)

Example:

Although this is NOT from our class, notice the level of focus and development that is required:

According to the unit, what role does a balanced, comparable history play in promoting social justice?

A balanced, comparable history plays a role in promoting social justice. As presented in the unit, social justice is the equal distribution of justice, respect and opportunity resulting in fair treatment for all. This concept avoids creating oppressed and marginalized groups. In order to reach a higher level of societal justice, the unit argues that America must have a comparable history. A comparable history is one that gains insight from diverse groups creating a bigger picture with more than one viewpoint. As all these viewpoints are given, the stories presented in the unit create a steady blanket of history which can be supported by one another. Without such, a master narrative is born that contains an incomplete story pushed by those with the power to write history as they please. These single stories pushed by the elite further creates a biased that works to exclude marginalized groups and their stories which are then misrepresented overall. The unit concluded that a single story is known to be incomplete, and to pinpoint a group of people as one thing and nothing else. Therefore, without a balanced comparable history, people gain a myopic, or narrow and ignorant view of history reestablishing the master narrative even more.

Aspire Toward Greatness

  • Use a minimum of 4-6 sentences.
  • Avoid I, me, our, you, my, we & and unreferenced pronounce.
  • Present you are from another planet and all you have is the unit content. Just focus on the content to inspire your logic
  • Keep reading the example above. Notice how the writer is intentional with their words. They are making sure all of the logic is inspired by the unit. There is NO personal reflection on their own opinions or experiences.
  • Read the rubric below

[supanova_question]

I have one assignment for march 1, 2020 Writing Assignment Help

The electronic portfolio assignment requires the use of Rasmussen Optimal Resume Electronic Portfolio resource. The student may choose to download prior quarter assignments that comply with the following transferable skills and additional requirements :

  • Personal mission statement
  • Resume
  • Letters of recommendation if applicable
  • Certifications if applicable
  • Critical Thinking
  • Team Collaboration
  • Diversity
  • Informatics
  • Digital fluency
  • Communication

For instructions for Optimal Resume, use the link below.

Optimal rasmussen resume portfolio.pdf

Once you have completed your portfolio, paste a link to it or a screenshot of it into a Word document. Include a 1-2 paragraph summary about your experience creating the portfolio, including what you liked/disliked about the process

[supanova_question]

Revision of a critical summary paper Writing Assignment Help

Revision of a critical summary paper Writing Assignment Help

× How can I help you?