Revision of a critical summary paper Writing Assignment Help

Comprehensive Assignment – Submission of your Final Research Proposal

Your final research proposal should consist of your 1. Introduction section with the purpose of the study and research question, and why your research is significant to the area of death and dying and who would benefit from your research. 2. Your literature review which should give an overview of peer-reviewed academic journal research (at least 5-8 articles) that deal with your topic and would help you to understand what research has been conducted related to your research question. Your literature review should have an opening and conclusion paragraph. The closing paragraph should identify any gaps in the literature and discuss what the main research methods are that have been used to research your topic. 3. Your methodology section describing how you would go about researching this topic including method, procedures, and any ethical issues with the research.

I have answer this questions but I am not sure if that is right so I want some one to fix and improve my answer if needed! please check fille call Homework 2 for more information for the ass

A fragment of human progranulin (PGRN, Homo sapiens) is overproduced in several human cancers.The fragment’s amino acid sequence is

GAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL

The fragment contains six repeats called granulins with the sequence pattern of

XXXCX…XCX…XCCX…XCCX…XCCX…XCCX…XCXXXXXX

where X is any amino acid residue, C is cysteine, … stands for one to several arbitrary amino acid residues in a row.

You would like to use one of the repeats (specifically, human granulin A, or hGrnA) as a protein marker for early cancer detection. As a part of your efforts to develop the diagnostic kit, you would like to quantify molecular interactions (affinity) between hGrnA and its cellular receptor (a protein known to bind hGrnA and trigger cell division upon binding).hGrnA is the third repeat out of the six if counting from the N-terminus.

To produce hGrnA you have decided to sub-clone it into the Novagen expression vector pET-21a between restriction sites HindIII and XhoI.The recombinant DNA construct must have the following specifications: a) The enterokinase cleavage site DDDDK to ensure that the N-terminal amine of the recombinant hGrnA after treatment with enterokinase is free and available for binding to the receptor; b) An arginine residue (R in one-letter code, Arg in three letter code) immediately after the last residue of hGrnA to improve the construct solubility, and c) a C-terminal hexahistidine tag after (His-tag, His₆) to enable hGrnA purification.

Your assignment is:

• Identify the amino acid sequence of hGrnA for subcloning.
• Design the DNA sequence encoding hGrnA optimized for Escherichia coli expression (use any K12 E. coli strain) and amenable for cloning between HindIII and XhoI restriction sites.Make sure that the back-translated optimized DNA sequence of hGrnA does not contain restriction sites HindIII and XhoI.Use genomes.urv.es/OPTIMIZER as shown during the class (codon usage HEG, method “guided random”).
• Design two primers (one forward and one reverse) with melting temperatures Tm equal to approximately 60-62°C for subcloning the synthetic gene into the pET-21a plasmid and creating a recombinant DNA construct that will satisfy the specifications a)-c).

The report must be submitted as a Word file.

Argumentative Essay Assignment SheetWhat is it? In this type of assignment, you take a stand on a particular topic that is debatable. You present a clear and strong thesis statement in your first paragraph to assert your position on the topic. You then provide strong, logical evidence that supports the validity of your argument throughout your paper. However, you will not research this topic. Consider your audience! Who is the intended audience of your paper? Knowing your audience is essential to making a strong argument. Ask yourself the following: What does your audience value and believe? For the purposes of this assignment, you are going to assume that the audience disagrees with your stand. Keep this in mind when writing the paper. Your argument is going to be more convincing if you show that you have taken the situation of your audience into account.How will their interests be affected by the issue? In other words, why should your audience care about this issue? This question can also be broader—why should anyone care about this issue? What kind of evidence will be most effective with them? Your evidence will be based on your personal experience and that of one of the articles included in the module. DO NOT RESEARCH or PLAGIARIZE! If you have questions about this, ask! Even short passages taken from an outside source will constitute plagiarism.For this essay, you may write in either first or third person point of view. However, you will avoid “I feel” or “I believe” or “I think” statements. Do not write in second (you, your, you’re). What are the requirements?Your argumentative essay will include the following:

1. You will select a topic from those listed in the module using the articles and you will include directly quoted passages from the article you select in your essay as evidence. When using passages from the article, quote them and introduce them fully using the author’s name and the title of the article as shown in the example in the module.

2. Have a clear thesis with a topic, how you feel about it, and why (see the examples in the module).

3. Include all of the important details—who, what, where, when, and why.

4. Include evidence from your own experience as well as evidence from an article in the module.

5. Include refutation—what is the opposition likely to say? This is where you will note what those against your argument are likely to counter-argue. You will then refute this argument and state why it is not as strong as your own stand. Remember to make it clear this is refutation and not your stand.

6. Conclude with a summation of the essay and perhaps a question or idea that leaves the reader with something to consider.

An example outline to help you with your writing would be the following:INTRODUCTION: Usually first paragraph but could be first two paragraphs. Make your introductory paragraph interesting. How can you draw your readers in? What background information, if any, does the reader need to know in order to understand your claim? Give your thesis at the end of the introductory paragraph and make sure it includes the topic, what you will argue about it (your stand) and why. NEXT: SUPPORTING EVIDENCE PARAGRAPH: Usually this is one paragraph but it can be longer. What is one item, fact, detail, or example you can tell your readers that will help them better understand your claim/paper topic? Your answer should be the topic sentence for this paragraph. Introduce your evidence either in a few words (As so in so states in the article from the module.) What supporting evidence (reasons, examples, personal examples, examples from the article you selected) can you include to prove/support/explain your topic sentence? Explain Evidence: How should we read or interpret the evidence you are providing us? Remember, this is

personal evidence or evidence from the article but not researched evidence. How does this evidence prove the point you are trying to make in this paragraph? Link this evidence to your thesis.SUPPORTING EVIDENCE PARAGRAPH #2, 3, 4 or however many paragraphs you use for evidence (at least 2). Repeat above. COUNTERARGUMENT PARAGRAPH or REFUATION: PURPOSE: To anticipate your reader’s objections; make yourself sound more objective and reasonable. Usually 1-2 paragraphs. What possible argument might your reader pose against your argument and/or some aspect of your reasoning? Insert one or more of those arguments here and refute them. End paragraph with a concluding sentence that reasserts your paper’s claim as a whole. Make it very clear that this is what the opposition would think and not what you are asserting. CONCLUSION: Remind readers of your argument and supporting evidence. Restates your paper’s overall claim and supporting evidence. How long should it be?At least 2 full pages. This is a minimum requirement that you must meet. You may always go over the minimum but never under. It must be turned in on time; (you are allowed one late essay for the semester, but it will receive a one

letter grade reduction).

Your paper will be set up in MLA style as shown in the paper layout power-

point in the module.

How will it be assessed?

The rubric gives the details on this. You can also review the sample essays

in the text and modules.

Option 1: For your argumentative essay, read the following and respond to it using a clear

thesis, background information, definition of the topic, proofs, and refutation (as explained in

the power-point and the textbook). You will not research this topic. Instead, you will respond

to this article. You will use directly quoted passages from the article for support. You will

document these passages by introducing the author’s full name and the title of the article on

first reference and then using the author’s last name after the quoted or summarized passages

in parentheses like this (Richie). These passages should represent a very small percentage of

your essay. Your words should take up more than 80% of the essay’s two-page minimum. As

always, set this up as you have all previous assignments in MLA style.

Technology is supposed to make us more connected. We can stay in touch with our friends all the

time on Facebook, Twitter and Tumblr, and, of course, by texting. But are our smartphones

actually getting in the way of real socializing? Could technology be making us more alone?

In the article “

Disruptions: More Connected, Yet More Alone,” Nick Bilton writes about a

YouTube video that comments on our smartphone-obsessed culture.

Last weekend, I was watching television with a few friends, browsing the week’s most popular

YouTube videos, when a piece in the comedy section called “I Forgot My Phone” caught my

eye. As I was about to click play, however, a friend warned: “Oh, don’t watch that. I saw it

yesterday, and it’s really sad.”

The two-minute video, which has been viewed more than 15 million times, begins with a couple

in bed. The woman, played by the comedian and actress Charlene deGuzman, stares silently

while her boyfriend pays no mind and checks his smartphone.

The subsequent scenes follow Ms. deGuzman through a day that is downright dystopian: people

ignore her as they stare at their phones during lunch, at a concert, while bowling and at a

birthday party. (Even the birthday boy is recording the party on his phone.) The clip ends with

Ms. deGuzman back in bed with her boyfriend at the end of the day; he is still using his phone.

Ms. deGuzman’s video makes for some discomfiting viewing. It’s a direct hit on our

smartphone-obsessed culture, needling us about our addiction to that little screen and suggesting

that maybe life is just better led when it is lived rather than viewed. While the clip has funny

scenes — a man proposing on a beach while trying to record the special moment on his phone —

it is mostly … sad.

Students:

Tell me …



Does technology make us more alone? Do you find yourself surrounded by people who

are staring at their screens instead of having face-to-face conversations? Are you ever guilty of

doing that, too?



Is our obsession with documenting everything through photographs and videos

preventing us from living in the moment?



Do you ever try to put your phone down to be more present with the people in the room?



Do you have rules for yourself or for your friends or family about when and how you use

technology in social situations? If not, do you think you should?



Do you think smartphones will continue to intrude more into our private and social

spaces, or do you think society is beginning to push back?

The assignment is to create a one page products sell sheet for a product I came up with which is a fiber glass bottle. Attached are all the work and information you need about my product. Please review all the documents attached and incorporate all the information I wrote into the product sell sheet. Also attached is an example of a product sell sheet that you should very carefully follow. I expect for all of the information that I provided to be used exactly as is in the product sell sheet. I also attached a design I created for the fiber glass bottle that you need to incorporate in the product sell sheet. Please make sure the total outcome has the correct and precise information as well as a nice design just like in the product sell sheet example. Last but not least, please provide a box on the left upper corner of that document you’re going to make in order for me to put the information in just like the example.